Here is Todays List of Ebooks from AwesomeGang

Published: Thu, 12/31/15

 

Good Morning Awesome Readers!
 
Here is your list of books that are featured on Awesomegang.com. These books might be free or discounted for only a limited time so make sure you download them as soon as you can. I am sorry if some are not free by the time you open the newsletter. 
 
New Books – Awesome Gang

http://awesomegang.com

Where Awesome Book Readers Meet Awesome Writers

  1. Heart of the Ronin 

9781497638211About Heart of the Ronin:

“A fusion of historical fiction and adventure fantasy, the first volume of Heermann’s Ronin Trilogy is a page-turning folkloric narrative of epic proportions…. [His] writing style is confident and fluid, his characters well developed and his serpentine story line anything but predictable. Numerous tantalizingly unresolved plot threads will have readers anxiously awaiting the second installment in this gripping tale of ill-fated love, betrayal and destiny.” – Publishers Weekly

“Full of sword battles, intrigue, romance and fantastic elements blending well with historical ones, Heart of the Ronin is a very impressive opening in the Ronin Trilogy. It’s also a page turner that you can’t put down and will leave readers begging for more.”– Fantasy Book Critic

“Heart of a Ronin is a solid, likeable adventure story, sure to please fans of Japanese culture and fantasy readers alike.” – Adventures in Sci-Fi Publishing

Thirteenth-century Japan is a dangerous place, even in a time of peace. Capricious gods, shape-changing animals, and bloodthirsty demons are as real and unpleasant as a gang of vicious bandits. From the wilderness emerges a young, idealistic warrior with his father’s mysterious sword on his hip, a wise, sarcastic dog at his side, and a yearning in his heart to find a worthy master. He dreams only of being samurai.

Finding a master should be easy for a warrior as skilled as Ken’ishi, but the land has settled into an uneasy peace and cast multitudes of proud, powerful warriors to the four winds. These masterless warriors, ronin, often must stoop to crime and banditry to feed themselves. Ken’ishi finds himself plagued by the hatred and mistrust of peasants and samurai alike.

When he saves a noble maiden from a pack of bandits, he and his faithful dog become enmeshed in the intrigues of samurai lords, vengeful constables, Mongol spies, and a shadowy underworld crime boss known as Green Tiger. But Ken’ishi has a few secret weapons of his own, granted to him by his mysterious past and his magical upbringing. If only he knew more about his mysterious past, his parents’ murder, and the sword that seems to want to talk to him. . . .
Heart of the Ronin is an action-packed historical fantasy, set against the backdrop of ancient intrigue and impending war, the first of a sweeping three-part epic filled with deadly duels and climactic battles. Creatures of folklore and myth are as real as the katana in one’s hand. And just as deadly.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Facebook Fan Page.
Visit the Twitter page.


Author Bio:
Freelance writer, novelist, award-winning screenwriter, editor, poker player, poet, biker, roustabout, Travis Heermann is a graduate of the Odyssey Writing Workshop and the author of Death Wind, The Ronin Trilogy, The Wild Boys, and Rogues of the Black Fury, plus short fiction pieces in anthologies and magazines such as Alembical, the Fiction River anthology series, Historical Lovecraft, and Cemetery Dance’s Shivers VII. As a freelance writer, he has produced a metric ton of role-playing game work both in print and online, including the Firefly Roleplaying Game, Legend of Five Rings, d20 System, and the MMORPG, EVE Online.

He enjoys cycling, martial arts, torturing young minds with otherworldly ideas, and zombies. He has three long-cherished dreams: a produced screenplay, a NYT best-seller, and a seat in the World Series of Poker.

In 2015, he moved to New Zealand with a couple of lovely ladies and a burning desire to claim Hobbiton as his own.



  1. Haunted (Book Four of the Hollow City Coven Series) 

HCC-Book-4-2-200x300About Haunted (Book Four of the Hollow City Coven Series):

An undead city. An ill-fated love. A nightmare relived.

Wiccan researcher Gillian Granger can hardly believe she’s reached her life’s goal, but the accomplishment is tempered. The ancient city of Tenebris holds as many terrors as it does wonders. As she and Shayne wander its ghostly streets, Gillian must finally admit she’s been there before.

But as the bond between her and Shayne grows ever deeper, they find that the city’s claim on him is just as strong. Though Gillian had once dreamed of finding the Hollow City, now she’ll do anything to escape.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.


Author Bio:
Hazel and her husband stopped being separate people years ago. They live their happy life in the always crowded, mostly sunny, and sometimes sweltering city of LA. Though they haven’t managed it yet, plans are afoot to add a kitty to the household, thereby giving the allergist fits.

Hazel has been writing full-time for several years, with some traditionally published work in other genres. But it’s her indie-published romance that fuels the creative fire. It turns out writing isn’t a job, it’s an obsession.

When you can pry Hazel’s fingers from the laptop, you’ll find her: on the elliptical watching a documentary, indulging her audiobook habit, or spending quality time with Candy Crush. Although she’s vegan, she’s a disaster in the kitchen. Luckily, potato chips and pinot noir come ready-made.



  1. The Exorcist’s Apprentice by Mark Lukens 

Exorcists-Apprentice-Cover-3About The Exorcist’s Apprentice by Mark Lukens:

For centuries the Roman Catholic Church has employed a select few to investigate the most extreme cases of demonic possession, haunted places, and paranormal activity. Often, the calling of an Investigator is passed down from father to son.

After surviving a tragic accident, seventeen year old Danny Lambert is sent to live with his father, Paul, who is an Investigator for the Church. At first Danny resists the calling to become an Investigator, but after the horrors he sees, he agrees to begin training with his father.

Danny and Paul are given their first assignment: the haunting of a house in a remote corner of upstate New York. Inside this house Danny will discover a horrifying, mind-blowing secret that will not only change his life, but how he sees everything forever.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Facebook Fan Page.
Visit the Twitter page.


Author Bio:
I’ve been writing since the second grade when my teacher called my parents in for a conference because the ghost story I’d written had her a little concerned.

Since then I’ve had several stories published and I’ve had four screenplays optioned by producers in Hollywood – one of which is in development. I’m the author of many bestselling books including: Ancient Enemy, Descendants of Magic, The Summoning, Night Terrors, Sightings, The Exorcist’s Apprentice, Devil’s Island, What Lies Below, Ghost Town: a novella, and A Dark Collection: 12 Scary Stories. I’m a member of The Horror Writers Association.

I grew up in Daytona Beach, Florida. But after many adventures and travels, I settled down near Tampa, Florida with my wonderful wife, son, and a stray cat we adopted.

 



  1. Arthur Zarr’s Amazing Art Car by Cathey Graham Nickell 

az-front-coverAbout Arthur Zarr’s Amazing Art Car by Cathey Graham Nickell:

Arthur Zarr is a quiet man with few friends. His life is rather plain, and his car is plain, too. But not for long! Mr. Zarr finds happiness and makes friends by building an amazing art car. What happens when Arthur enters his bedazzled car in the town’s annual Art Car Parade? In this whimsical story, children learn about recycling, community, friendship building, and the power of imagination. The book includes a “History of Art Cars” page for readers who’ve never heard of this creative form of artistic expression. It also has a subtle ABC theme, as Arthur Zarr adds objects to his art car in alphabetical order! Suitable for all ages, but especially children ages 4-8.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Facebook Fan Page.
Visit the Twitter page.


Author Bio:
Cathey Graham Nickell lives in Houston, Texas. Cathey doesn’t drive an art car herself, but she has a habit of covering the back of her SUV with bumper stickers! She also snaps pictures of art cars, which are plentiful in Houston, when she sees them. “Arthur Zarr’s Amazing Art Car” is her first children’s book. Cathey earned a bachelor of arts degree in Journalism from Baylor University in 1985. She received a master of arts degree from Louisiana State University-Shreveport in 2013. Cathey is married to Kevin Nickell, and together they have a blended family of four children. She also is the seeing-eye-person for her little blind dog named Cricket.



  1. Less Than a Lady 

Less-Than-A-Lady-Cover-ArtAbout Less Than a Lady:

To win a lord, you can’t be a lady…

Darcy Blake, Earl of Chase, is a soldier, rogue, and a loyal King’s man. Commanded to spy on the luscious actress Amelia Fox, Darcy must pretend to be her student for a court theatrical. He is certain he can school her in the art of seduction while discovering if she is a traitor. But to his shock, he finds Mrs. Fox teaching him an entirely different kind of lesson.

As London’s most popular actress, Amelia is famous at court, and she doesn’t have a husband to tell her what do. Unfortunately, the king has ordered her to train the rakehell, Lord Chase to act for the court. Before long, the Earl is driving her wild with desire and awakening her heart to love. As an actress, society dictates she can never be more than Lord Chase’s mistress, and Amelia has vowed never to be less than a lady.

When Darcy learns the witty actress is indeed linked to a traitor, he’ll have to decide if love or loyalty will rule the day.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.
Visit the Facebook Fan Page.


Author Bio:
USATODAY BESTSELLING AUTHOR, Eva Devon, was raised on literary fiction, but quite accidentally and thankfully, she was introduced to romance one Christmas by Johanna Lindsey’s Mallory novella, The Present. A romance addict was born. She devoured every single Lindsey novel within a few months and moved on to contemporary and paranormal with gusto. Now, she loves to write her own roguish dukes, alpha males and the heroines who tame them. She loves to hear from her readers. So please pen her a note! evadevonauthor@gmail.com



  1. Grace In Shoe Leather by Wayne Nall Jr 

grace book coverAbout Grace In Shoe Leather by Wayne Nall Jr:

In March, 1998, the Evansville, Indiana area was rocked by “The MotoMart Shooting” and the ensuing arrest of a local youth for murder. “Grace In Shoe Leather” is the true story of one victim’s widow who refuses to take the path of bitterness and resentment, but instead chooses the path of forgiveness and grace. In a surprising turn of events, that widow, Ina Kae Simpson, eventually befriends Erick Schmitt, the man convicted of taking her husband’s life. The unexpected results of this unusual friendship are inspirational!

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Facebook Fan Page.
Visit the Twitter page.


Author Bio:
Wayne Nall Jr (1964- ) is a former pastor turned blogger and author. As both an avid history buff and a life-long student of the Bible, he’s been blogging since 2010 at waynenalljr.blogspot.com about current events, historical interests, and cultural trends from a Biblical world view. He also has been blogging concurrently for Christianpost.com since 2012. Between the two blogs, he’s had over 15,000 views.

In December, 2014, he published his first book, “Grace In Shoe Leather.”



  1. Our Father: Understanding God 

ourfatherunderstandinggodAbout Our Father: Understanding God:

“Our Father: Understanding God” was written with one goal: to inspire and motivate youth to think of becoming good fathers and family leaders at the right time by showing them how simple is to understand Our Father, God.

If you’re a mom, a sister, a friend: you need to get this book for the teenage boys in your life. If you’re a teenage boy, this is destined for you. Just open the book and read the first chapter. You’ll see what I mean. You might not be able to put it down.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Facebook Fan Page.


Author Bio:
Originally from Romania and growing up under tough conditions in communism, Florin can say that he lived on both sides of the wall. After the Revolution in 1989 he, and the entire Romanian people, had to adapt to capitalism and find a career. Because of his personality, Florin was attracted by the entertainment industry and in particular by acting and film making.
Today, after 20 years in the industry, Florin is continuing his career on the other side of the planet, on the North American continent, precisely in Canada and extended his writing skills from film scripts and commercial copy-writing to becoming a published author.



  1. This Is Your Year! Purposely Engineering Your Breakthrough by Stephen Astor 

book-cover-2-revised-CopyAbout This Is Your Year! Purposely Engineering Your Breakthrough by Stephen Astor:

This Is Your Year: Purposely Engineering Your Breakthrough will be recognized as one of
the most influential books ever written. In this influential work, Stephen M. Astor
presents a comprehensive, unified, and groundbreaking approach to creating solutions for the most pressing personal, professional, and social obstacles that we all encounter. Bursting to the brim with deep intuitive wisdom and witty observations, Astor unveils a multitude of step-by-step methodologies for living powerfully, taking control of your life, and finally experiencing what living life on your own terms actually feels like. Translated into several languages, This Is Your Year: Purposely Engineering Your Breakthrough is a global catalyst for millions of people to reach the peak of their desires, and live life at a much higher level than ever possibly imagined.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Facebook Fan Page.
Visit the Twitter page.


Author Bio:
Stephen M. Astor chose a path that very few people would have chosen: he turned down trust fund money from his parents, carved his own existence, and made his own living. After collecting earnings from a friend’s fashion line that he invested in, he then reinvested that money into the development of multiple smartphone applications, becoming a silent partner — seeing very sizeable profits. After sharing many nuggets of wisdom with associates, he began success coaching, when one day one of his clients told him that he should write a book, and reach many more people. This is how the author the world will soon know came to be.

 



  1. 98 Best Travel Tips: A Guide For Travel Junkies on a Budget with Kids by Chris A. Baird 

98BestTravelTipsAGuideForTravelJunkiesonaBudgetwithKidsAbout 98 Best Travel Tips: A Guide For Travel Junkies on a Budget with Kids by Chris A. Baird:

LEARN: How to Travel More While on a Budget and With Kids!Do you wish you could travel more? Do you feel you don’t have enough money? Does traveling with kids seem too difficult?The good news is that you don’t need to struggle with this any longer. You already have everything you need to start taking more trips right away. You only lack the direction to making this happen.THE TRUTH?: You Are Not Traveling Because You Lack Knowledge.Most people want to travel more but lack the knowledge of how to make this a reality.For instance, have tried many times to plan a vacation only to realize you have too little money? Or maybe the idea of taking the kids on a trip seems like too much planning.In the book “98 Best Travel Tips: A Guide For Travel Junkies on a Budget with Kids” you will learn 98 powerful tips to start traveling regardless of your budget and how many children you have. This is the fifth book in the bestselling PowerLists™ book series. Each PowerList™ book is designed to help you get more out of life. DISCOVER: 98 Best Travel TipsIn “98 Best Travel Tips” you will discover that through a series of well-defined tips broken down into sections, you will be in a position to easily make a plan and set a budget for taking a trip you will never forget!You Will Learn:Why You Should TravelWhy You Don’t TravelWhere to StartManaging Safety and SecurityKeeping Costs LowPacking for the TripKicking Off the TripTips for Children on TripsHeading HomePlanning Your Next TripDOWNLOAD: 98 Best Travel TipsYou can learn just how easy it is to start traveling immediately. Everyone is different and if even a few of these tricks work for you, it will be worth the time.Are You Ready To Start?Quit waiting to get control of your vacations and act now.Go to the top of this page and click the “Buy now” button.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Amazon best-selling author, Chris, is a Senior Data Analyst living in Norway with decades of experience dealing with complex, simultaneous projects spanning military service as well as management, database development, and analysis in the oil and gas industry. He earned a Bachelor of Science from the United States Air Force Academy and advanced degrees in Information Resource Management and Human Resource AdministrationChris has a passion for finding productivity tricks and exploring better ways of working towards goals. In his spare time, Chris travels around Europe, takes photos, reads, and hikes around Norway. He wrote Achieve Your Goals Now With PowerLists™ because he is excited about helping people make their goals a reality; he has seen far too many people frittering away their time and money because of unclear goals.

 



  1. New Word A Day – Vol 5 by Elliot Carruthers 

NewWordADayVol5About New Word A Day – Vol 5 by Elliot Carruthers:

Improve your vocabulary with a word a day! Learn new words with funny cartoons and tricky riddles. Phonetic and simple explanations help you use the words in daily conversation. Enjoyable and entertaining!

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Elliot Carruthers has seventeen Microsoft certifications and builds computer based training systems for fortune 500 companies. As an expert in teaching systems, he realized there was something missing in the way vocabulary is taught and came up with the New Word A Day concept that breaks each word into its simplest idea. He realize d memory tricks were essential and that humor is needed to keep the learning fun.

 



  1. The Sun That Shines & The Storm That Will Always Pass 

Cover-Official-1About The Sun That Shines & The Storm That Will Always Pass:

The book is a romance story in which the main character learns how to live a life that’s true to himself. Derek Warmington, the American “genius poet” is young; in his twenties. He goes through many disappointments and periods of mania as he searches for the purpose of his own life. I wrote the book in a stroke of insight, as I was going through one of the worst most depressing years of my life. The motivation behind the book being written was love. I’m living my life by the first couple of pages in the book. I.e. philosophy / self-actualization. My poetry is about real life, there’s nothing whimsical about it.

86 pages of magical storytelling. The Sun That Shines & The Storm That Will Always Pass is a reverie of philosophical adventure. Combining both poetics and philosophy. It was written after a breakup. It’s meant to be a book that people can read when they’re in the mood for reverie. Poetry that fills the soul. The words throughout the book are healing by nature.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Twitter page.


Author Bio:
I’m from Cypress, TX. I published my first poem at the age of seven. I venture mostly between Cypress, TX and Austin, TX. I also lived in Phoenix, AZ for a year, when I was 19. After high school I traveled across the southern United States with a band of vagabonds. I’m planning to publish another book entitled “Ruminations: Truth, Evolution, & Existentialism,” in late 2016. This book was written from about September – November 2015. The idea of writing poetry just came to me one day after my girlfriend didn’t answer the phone. I really consider myself more of an innovator than a poet. I’m also starting a company called Dear Drama. My Twitter handle is @DWarmingtonn.

 



  1. Xaman by Simone Beaudelaire 

XAMAN-COMPLETE_500About Xaman by Simone Beaudelaire:

In the jungles of Belize, an ancient power lurks, and American grad student Rachael Monroe is about to come face to face with it. But is it a monster from a long-dead culture, or something far more dangerous? And who is Xaman, the mysterious local man Rachael finds so inexplicably fascinating?

Seeking answers to these questions will lead Rachael deeper into the heart of a centuries-old mystery that might reveal to her a love that can surpass even death… or her own gruesome end.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.
Visit the Facebook Fan Page.
Visit the Twitter page.


Author Bio:
Simone Beaudelaire is the pseudonym for a single mom and graduate student from Texas. In her spare time, Mme Beaudelaire reads romances as fast as she can get her hands on them, and when she isn’t reading them, she’s writing them!

 



  1. Minimalist Lifestyle – Less is the new more (minimalism, life, living, simplify, decluttering, simplify, stress free, bliss) by Christina Simone 

MinimalistLifestyleLessisthenewmoreminimalismlifelivingsimplifydeclutteringsimplifystressfreeblissAbout Minimalist Lifestyle – Less is the new more (minimalism, life, living, simplify, decluttering, simplify, stress free, bliss) by Christina Simone:

Less IS the new more….

The minimalist lifestyle, originally inspired by the minimalist art movement, puts emphasis on extreme simplification. When you simplify the seemingly complicated aspects of your life, you become more in tune with your heart’s desire.

My hope is that this book inspires you to transform your life to do what you love, and do it with passion. That you also take steps to set priorities in your life and reduce stress including eliminating unnecessary things in your life to gain freedom and inner-peace.

This book will introduce you to the minimalist lifestyle and the principles behind it. It will also guide you in creating a minimalist home, a diet plan, and an exercise routine. Furthermore, you will extend to learning about how to build a minimalist wardrobe, apply minimalism in personal finance, and how to enjoy traveling as a minimalist.

This book is for everyone who wants to make their lives more meaningful by focusing on what matters to them the most.

This is what minimalism is all about, and it all starts here.

Download this book now while it is priced at only .99 over the festive season.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.

Author Bio:
Christina Simone is a mother of two sons, both of whom have left the nest and are following their own life journeys. After making a decision to leave a highly stressful executive position, she now follows her bliss and travels South East Asia with her wonderful husband of 27 years and writes to inspire others to trust their very own journey and to really live in the moment and embrace what truly matters to them.She is a very strong advocate of healthy body + healthy mind = healthy life.Christina welcomes valuable feedback from her readers and also offers free copies of her new books to early subscribers. If you are interested in receiving a free copy of her new books as they are released, please contact her directly via email:christinaDsimone@gmail.comHer website will be live soon and it will feature her other books.

 



  1. Wicca: A Beginner’s Guide to Becoming a Solitary Practitioner 

12415920_924825494281744_551010951_oAbout Wicca: A Beginner’s Guide to Becoming a Solitary Practitioner:

Use this book, and the techniques revealed within to build up your skills in fields like spell casting to candle magick to divination in the pursuit of becoming a fully actualized wiccan! Through its teachings, the religion of Wicca promotes awareness, love and respect for the Sun and the sunlight, Moon, rivers, winds, rain and mountains, the animal kingdom, flowers and trees, the soil beneath our feet, the colorful autumn and the winter snow. Wicca teaches us that everything that surrounds us is made of energy, and it embraces the principle of duality in all creation. This entails the existence of a God and Goddess, the masculine and feminine energy, the positive and negative. The whole Universe is made of such energy and Nature itself is a beautiful manifestation of the duality principle as we, human beings, hold the spark of duality within us. Here’s what you can expect to find in this book… The History of Wicca and Witchcraft Wicca Gods and Goddesses Sabbats Esbats Stones and Crystals Using Oils Plants and Herbs Spellcraft Wicca Candle Magick Paper Magick Divination And Much More!

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.

Author Bio:
Lucilla Olson

 



  1. Ketogenic Diet: Tips and Strategies to Adapting to the Lifestyle and Sticking to it, Recipes for Delicious Meals, and Everything You Need to Know About Going Ketogenic Like a Pro 

12414207_926174047480222_1180128404_oAbout Ketogenic Diet: Tips and Strategies to Adapting to the Lifestyle and Sticking to it, Recipes for Delicious Meals, and Everything You Need to Know About Going Ketogenic Like a Pro:

Use this books and the techniques revealed within to build the body of your dreams with a Ketogenic or low carb diet; watch as your body burns off any fat you carry like butter!
Originally developed in 1924 by Dr. Russell Wilder at the Mayo Clinic, the ketogenic diet was very effective in the treatment of epilepsy that didn’t respond to the current medications for that disease. Despite the studies showing how effective the diet was in treating epilepsy, especially in young children, it fell out of favor after the discovery of new anti-seizure medications in the 1940s. The ketogenic diet is very closely related to the paleolithic diet which also excludes carbohydrates. Unfortunately, today’s diet consists of a high level of carbohydrates which causes significant changes in our health. Carbohydrates are by far the most fattening ingredient in our diets. The ultimate goal of following a low-carbohydrate ketogenic diet is to improve your heath by making your body burn ketones rather than glucose for energy. Within this book you will learn what the ketogenic diet is and how it works, things you should know and do before starting this diet plan, and how to make it work for you. By following a balanced ketogenic diet, you can feel good in your own skin again! You’ll have more energy, your skin and hair will be smoother and more healthy, not to mention the reduction of stress, depression and anxiety that can nag you as you go about your day.
Here’s what you can expect to find in this book…
How Does a Ketogenic Diet Work? How Does a Ketogenic Diet Compare to Other Diets? What Should I Do Before Beginning a Ketogenic Diet? Counting Macros or Macro-nutrients and How Does This Help With the Diet What Foods to Avoid All Original Chef Designed Meal Plans and Recipes Making a Meal Plan to Fit Your Life Fitting All the Pieces Together And Much More!

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.

Author Bio:
James Kaplan

 



  1. Make Money Online: Realistic, Proven And Most Profitable Ways To Make Money Online Starting Today 

make-money-real-coverAbout Make Money Online: Realistic, Proven And Most Profitable Ways To Make Money Online Starting Today:

Are you finally ready to start making money online? If so, this book is a must read!There are thousands of people just like you making money online every sigle day and there is not reason at all why you can’t be one of them. This is where “Make Money Online – Realistic, Proven And Most Profitable Ways To Make Money Online Starting Today” comes in. This book was written to help anyone who is serious about making some sort of income online how to do it and how to start doing it quick.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Earl Stringer is an internet entrepreneur that enjoys sharing his knowledge
that he has obtained over the years.

 



  1. Mail Order Brides of Hope Springs Three Book Boxed Set: A Clean Historical Mail Order Bride Romance by Trinity Bellingham 

MailOrderBridesofHopeSpringsThreeBookBoxedSetACleanHistoricalMailOrderBrideRomanceAbout Mail Order Brides of Hope Springs Three Book Boxed Set: A Clean Historical Mail Order Bride Romance by Trinity Bellingham:

Always FREE on Kindle Unlimited
Three heart warming mail order bride stories for the price of one…
Mail Order Brides of Hope Springs Three Book Boxed Set includes:
TILLIE – a young runaway for a handsome lawyer
MILLIE – an orphaned and scarred bride for the Sheriff
MAIL ORDER BRIDE FOR CHRISTMAS –

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Trinity Bellingham has always been fascinated by the often intriguing lives led by frontier women and after discovering her great, great grandmother was wife to a rancher in Nebraska, has had personal reasons for writing about the lives of women of the West. She enjoys the simple things in life and has learned through the Grace of God, the benefits of living by Christian values. Trinity loves spending time with her children and grandchildren, as well as brightening the world around her by growing flowers. Writing inspirational historical fiction is Trinity’s way of showing how lives can change for the better when God is added to the mix, as well as to pay tribute to the brave women who settled the West.

 



  1. Love Him Love His Mother: A Clean Historical Mail Order Bride Romance (Wyoming Mail Order Brides Book 2) by Trinity Bellingham 

LoveHimLoveHisMotherACleanHistoricalMailOrderBrideRomanceWyomingMailOrderBridesBook2About Love Him Love His Mother: A Clean Historical Mail Order Bride Romance (Wyoming Mail Order Brides Book 2) by Trinity Bellingham:

Always FREE on Kindle Unlimited –

Love Him Love His Mother – This is the second book of my new Mail Order Bride Series – Wyoming Mail Order Brides

Cora O’Malley came out West with her best friend Annie to be a Mail Order Bride, however unlike Annie’s marriage, hers was a disaster and her husband died after only four months. After being left destitute, she has decided to never marry again, but rather, take control of her own destiny, start her own business, earn her own money and remain beholden to no-one, especially a husband.

Jeremy Josiah Paine is the man Annie was supposed to marry when she came out West as a Mail Order Bride, but his mother intervened to prevent the match. In fact, there isn’t a woman alive who could live up to the expectations of Myra Paine. When Jeremy finds himself falling for Annie’s friend Cora, he doesn’t know how he will deal with his sharp tongued, snobbish and shrewish mother. Cora is not a lady and worse, Irish. He fears his mother will suffer from am apoplexy when she finds out.

Betrayal, a bank robbery and a kidnapping play their part in the romance between Cora and Jeremy. An unlikely alliance forms between bitter enemies as their destiny plays lout. Does God play a role in their lives and does good triumph over evil? This Mail Order Bride Romance highlights some of the many difficulties faced by women during the nineteenth century on the American Frontier as well as how men thought it was OK to behave.

Scroll up and click the BUY button (FREE on Kindle Unlimited) to find out how Mail Order Brides of the West coped with some of the most challenging situations women have ever had to face … This book can be read as a stand alone book if desired, however there are plenty of adventurous tales to enjoy if you are interested in the whole Wyoming Mail Order Bride Series

Book 1: Second chance Mail Order Bride: http://amazon.com/dp/B01676BOEQ
Book 2: Love Him Love His Mother: http://www.amazon.com/dp/B0166EJACC
Book 3: The widow and the Widower: http://amazon.com/dp/B016TKP6EO
Book 4: Two Miracles for Christmas: http://amazon.com/dp/B017JL1IZ8

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Trinity Bellingham has always been fascinated by the often intriguing lives led by frontier women and after discovering her great, great grandmother was wife to a rancher in Nebraska, has had personal reasons for writing about the lives of women of the West. She enjoys the simple things in life and has learned through the Grace of God, the benefits of living by Christian values. Trinity loves spending time with her children and grandchildren, as well as brightening the world around her by growing flowers. Writing inspirational historical fiction is Trinity’s way of showing how lives can change for the better when God is added to the mix, as well as to pay tribute to the brave women who settled the West.

 



  1. Forest Friends: Young Readers Chapter Books (Animal Friendship Adventures Book 3) by K.B. Shaper 

ForestFriendsYoungReadersChapterBooksAnimalFriendshipAdventuresBook3About Forest Friends: Young Readers Chapter Books (Animal Friendship Adventures Book 3) by K.B. Shaper:

Three great stories about friendship and adventure
A chapter book with three great adventure stories featuring fun forest animal friends. (140 pages)

Meet Billy the bobcat, Maple the chipmunk, Russell the stag deer, Hazel the badger, Freddy the fox and the whole bunch, as they have fun adventures and make new friends while dealing with trouble, adventure, and sometimes even bad attitudes. They learn a thing or two about being friends.

1 – In Neighbor Problems, Billy and Maple are not being good neighbors. Hazel is tearing up the forest floor looking for roots. Sid’s leaves start disappearing from his den. What’s going on? Has everyone in the forest gone wild? It’s time to settle things down and learn how to be good neighbors.

2 – New Adventures with Old Friends: Freddy used to live in the forest and be a wild adventurous fox. He’s come back to visit and take some of the young animals on a wild adventure to the frozen lake. New adventures bring new troubles and someone gets lost.

3 – New Friends and Danger: There’s a new family in the forest. Hooray! But there’s something else new in the forest. An intruder who wants to take over the forest and kick everyone else out. The forest friends need to run and find their extended friends and family from all over yonder to ask them for help. Can they bend together with family and friends to overcome this problem?

More Great Friendship Chapter Books:
Ocean Friends http://www.amzn.com/B00NYBTNAK/
Park Friends http://www.amzn.com/B00OSP0BMA/
Forest Friends http://www.amzn.com/B00OS7I4AE/

Parents: Three(3) fun, adventurous stories about friendship – 5-6 chapters/45pages each. Appropriate for your chapter book readers ages 6-8, 8-10, 9-12, depending on their reading abilities.

Kids Chapter Books
Young Reader Chapter Books for children ages 6-8, 8-10, 9-12

Tags: Early Chapter Books, Chapter Books, ages 6-8, ages 8-10, ages 9-12, forest life, mammals, friendship, adventure, forest, deer, foxes, wolves, coyotes, bobcats, chipmunks, Young Readers Chapter Books, early chapter books, children chapter books, kids chapter books, forest friends, making friends.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Kevin loves to write for kids. He remembers the adventure he had reading as a kid and loves to contribute to that for other kids.

 



  1. Patchwork People: The dead can still talk. A dark legal mystery and suspense thriller. (Patchwork People series Book 2) by D.B. Martin 

PatchworkPeopleThedeadcanstilltalkAdarklegalmysteryandsuspensethrillerPatchworkPeopleseriesBook21About Patchwork People: The dead can still talk. A dark legal mystery and suspense thriller. (Patchwork People series Book 2) by D.B. Martin:

The dead can still talk, even when you think the living have had their say.A tense psychological thriller for fans of Gone Girl and The Girl with No Past. Who is taunting Lawrence Juste with blackmail notes and damning parcels of evidence linking him to a ten year old murder? And why do they want him to have to dig into his buried past in order to clear his name? Are they from the woman he started an affair with before his wife was even cold in her grave? Or his half-mad sister, even though she’s always adored him? It can’t be the childhood enemy he’s just tacitly agreed a stand-off with in court, leaving his reputation as a top British barrister in the balance. That would spell disaster for both of them. No, none of them have a motive for seeing Lawrence destroyed. That only leaves one other possibility; the most impossible of all…Is Lawrence Juste really as black as he’s painted? Only the past can say, but maybe the dead will tell tales…Noir at its most intriguing, deceit at its darkest, and moral bankruptcy at its most disturbing. Patchwork People is the second book in this gripping psychological thriller series.˃˃˃ What the reviewers say: “Martin has continued her masterful story of Lawrence Juste, his past, and his attempts to be the kind of man his hero Atticus Finch would be proud of… You can feel his frustration and his anxiety throughout the whole book…. What seems to be an unravelling in Lawrence’s life, is more of the piecing together the quilt of truth…It’s a great novel.” – lilmizflashythang.wordpress.com/2014/10/13/d-b-martins-patchwork-people-the-patchwork-people-trilogy-book-two/“Let me put it this way…Here’s one reader who can’t wait to see how this Trilogy finishes! Brilliant illustration of the psychology of people and how our minds can both conceal, reveal…and hide, even from ourselves… Amazing Novel!”- GABixlerReviews

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Debrah Martin is a British author, writing psychological thrillers as D.B. Martin and literary fiction as Debrah Martin. She also writes a YA teen detective series under the pen name Lily Stuart; irreverent, blunt, funny and vulnerable. She lives near Oxford in the UK with her daughters, and teaches creative writing and publishing when she’s not planning another mind-twisting plot. If you would like to read one of her books free of charge, sign up to her newsletter list here: http://eepurl.com/3-965 and be surprised!You can also find out about all of her books on her website www.debrahmartin.co.uk”Books are a chance to visit a world that you wouldn’t otherwise experience. As long as someone enjoys slipping into the other worlds that I write about, I’ll keep opening the doors for them. Dance in the rain, live in the sunlight, explore in your imagination…”

 



  1. Patchwork Pieces: Sometimes natural justice is the only justice. A mystery and suspense thriller. (Patchwork People series Book 3) by D.B. Martin 

PatchworkPiecesSometimesnaturaljusticeistheonlyjusticeAmysteryandsuspensethrillerPatchworkPeopleseriesBook31About Patchwork Pieces: Sometimes natural justice is the only justice. A mystery and suspense thriller. (Patchwork People series Book 3) by D.B. Martin:

Concluding the award-winning trilogy…An explosive psychological thriller series for fans of Gone Girl and The Girl with No Past. For a British barrister to forsake the law, the reason must be serious. For him to step all the way outside of it, the reason must be deadly. Lawrence Juste is a very different man to the one everyone thought he was. He’s a very different man to the one he thought he was too. But then, when you’ve just found out your whole world has been built around everyone else’s deceit and your lies are fairy tales by comparison, why should anyone be as they appear to be? Or anything end how it appears to end? Especially if there’s revenge involved and you’re a man on the edge of oblivion.Vigilante justice, murder, or just rewards? You choose.Patchwork Pieces is the final book in the Patchwork People series.˃˃˃ What the reviewers say:”‘Just because you’re related doesn’t mean you can trust anyone.’ Psychological thriller fiction” is the assigned genre of the PATCHWORK project…Now, with PATCHWORK PIECES, I get it… It is difficult to review the third in a set that has a single plot as complex as this one. It will make a great TV series if anyone can do it, something like BBC’s “Broadchurch” (“Gracepoint” in the United States)… brilliant, to be sure…”- Karen Dahood – Bookpleasures“This is a brilliantly plotted trilogy, full of intricate planning that is full of obfuscating activities until only, as the final book is ending, that the main character has begun to understand, even if he doesn’t know the full truth yet, that, finally, readers will know it all, even as he learns, and accepts, the total truthful amazing story! Simply fantastic!” – GABixlerReviews

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Debrah Martin is a British author, writing psychological thrillers as D.B. Martin and literary fiction as Debrah Martin. She also writes a YA teen detective series under the pen name Lily Stuart; irreverent, blunt, funny and vulnerable. She lives near Oxford in the UK with her daughters, and teaches creative writing and publishing when she’s not planning another mind-twisting plot. If you would like to read one of her books free of charge, sign up to her newsletter list here: http://eepurl.com/3-965 and be surprised!You can also find out about all of her books on her website www.debrahmartin.co.uk”Books are a chance to visit a world that you wouldn’t otherwise experience. As long as someone enjoys slipping into the other worlds that I write about, I’ll keep opening the doors for them. Dance in the rain, live in the sunlight, explore in your imagination…”

 



  1. Paleo Diet and Recipes – Easy Weight Loss (Paleo, Paleo diet, Paleo for beginners, Paleo cookbook, Paleo recipes, Paleo slow cooker, Paleo breakfast, Paleo lunch, Diet) by Emma Katie 

PaleoDietandRecipesEasyWeightLossPaleoPaleodietPaleoforbeginnersPaleocookbookPaleorecipesPaleoslowcookerPaleobreakfastPaleolunchDiet1About Paleo Diet and Recipes – Easy Weight Loss (Paleo, Paleo diet, Paleo for beginners, Paleo cookbook, Paleo recipes, Paleo slow cooker, Paleo breakfast, Paleo lunch, Diet) by Emma Katie:

Lose as much as a pound a day of body Weight while enjoying full, healthy meals?

Are you a busy woman who’d love recipes that are quick and easy?

✔✔✔ KINDLE NOT REQUIRED to read this book. Available for immediate reading with your Amazon virtual cloud reader. PRIVILEGE PASS ACCESS JUST AFTER THE CONCLUSION FOR A LIMITED TIME—FREE BONUS EBOOK INSIDE.

Do you find that you don’t have enough time to prepare healthy and delicious meals and snacks?

Would you love to have more energy, be happier and feel healthier every single day?

Do you want an abundant supply of delicious, quick and easy recipes at your fingertips?

If any of the above questions made you say “Yes”, then this book is for you!

Is the Paleo diet just another fad diet?

No, in fact it is the diet humans were designed to eat. Also known as the Primal diet, the Caveman diet and the Stone Age diet, the Paleo diet has literally been around as long as men and women have roamed the earth.

What is the Paleo Diet?

The low-carb, high-protein diet is a simple, healthy way to lose weight and feel better. Enjoy the best health of your life, and lose weight while preventing and treating diabetes, hypertension, heart disease, cancer, osteoporosis, and many other modern illnesses.

Is the Paleo diet healthy or will I have to starve in order to lose weight?

The Paleo diet focuses on weight loss and muscle tone through healthy eating and full-sized portions. Calorie counting, starvation, or unhealthy changes to your diet are not a part of the Paleo lifestyle.

The Paleo diet avoids processed foods that can be difficult for the body digest and contain unhealthy chemicals and additives.

The only diet that helps you to lose weight while enjoying full, healthy meals, the Paleo diet has been proven by the medical community to help treat and prevent many of our modern health maladies.

Why postpone losing weight, feeling healthy and increasing energy one more day?

This is your solution, and you will access TODAY when you DOWNLOAD this book.

This book is Free for Kindle Unlimited Users. Just scroll up and hit the “Buy” Button to get your own copy.

To Weight Loss Success and a cracking new sustainable healthy lifestyle!

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Horizons Media

 



  1. Patchwork Man: What would you do if your past could kill you? (Patchwork People series Book 1) by D.B. Martin 

PatchworkManWhatwouldyoudoifyourpastcouldkillyouPatchworkPeopleseriesBook11About Patchwork Man: What would you do if your past could kill you? (Patchwork People series Book 1) by D.B. Martin:

Years spent hiding from his past. Today it finds him.A gripping psychological thriller for fans of Gone Girl and The Girl on the Train. Lawrence Juste is a man with a past, so cleverly stitched together he thought it could never come unravelled. But two things are about to pick it apart, piece by sordid piece: a child and a dead woman. Faced with the blackmail note his dead wife has left him, and the belligerent boy she wants him to defend against a murder charge, Lawrence’s carefully ordered world begins to fall apart. Forced to seek out the very people he’s been running from most of his life, another even more horrifying possibility surfaces. The boy might even be his son; and the mother? The sister Lawrence was separated from as a child himself…And with so many secrets; who really is Lawrence Juste? Patchwork Man is the winner of a BRAG Medallion Award.˃˃˃ What the reviewers say:“Patchwork Man is as compelling as last year’s psychologically taut, legal procedural “Apple Tree Yard” by Louise Doughty, and is as unrelentingly concerned with social justice for the poor as Elizabeth George’s stunning “What Came Before He Shot Her” (Inspector Lynley Book 14, 2006). Like those authors, D.B. Martin is not afraid to bring her readers to unpleasant realities, distasteful characters, and to moral questions that have no simple or, perhaps, any permanent solutions… [A] thought-provoking and sometimes gut-wrenching series.” Karen Dahood – Bookpleasures“Whew! Nothing prepares you to face a book of your life based upon all the horrors, lies, and secrets that were kept in order for you to one day walk away and go to college… Highly recommended!”GABixlerReviews

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Debrah Martin is a British author, writing psychological thrillers as D.B. Martin and literary fiction as Debrah Martin. She also writes a YA teen detective series under the pen name Lily Stuart; irreverent, blunt, funny and vulnerable. She lives near Oxford in the UK with her daughters, and teaches creative writing and publishing when she’s not planning another mind-twisting plot. If you would like to read one of her books free of charge, sign up to her newsletter list here: http://eepurl.com/3-965 and be surprised!You can also find out about all of her books on her website www.debrahmartin.co.uk”Books are a chance to visit a world that you wouldn’t otherwise experience. As long as someone enjoys slipping into the other worlds that I write about, I’ll keep opening the doors for them. Dance in the rain, live in the sunlight, explore in your imagination…”

 



  1. PARANORMAL: Blood Family: Vampires, Shapeshifters, Panthers & Kitsunes (Titanium Blood Series Book 1) by Charlotte Raine 

PARANORMALBloodFamilyVampiresShapeshiftersPanthersKitsunesTitaniumBloodSeriesBook1About PARANORMAL: Blood Family: Vampires, Shapeshifters, Panthers & Kitsunes (Titanium Blood Series Book 1) by Charlotte Raine:

Liam Westfield, builds motorcycles while keeping his vampire instincts in check, has spent most of his life trying to avoid involvement with his father’s biker gang.

When his father is killed, Liam is forced to take his father’s place as the leader of the Blood Lust Brothers and begins his search to identify his father’s killer.

Now as his brother, August, conspires to take over the gang, and his father’s killer seems more dangerous than predicted, Liam has to find a way to stay one step ahead of both his unnaturally old family and his new, unknown enemy.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Charlotte Raine is a best selling suspense author. Charlotte gets inspiration for her writing from the scenic mountains around her home near Vail, Colorado.When she is not writing you will find her after a long day of skiing at one of the many lodges in Vail. She will most likely be next to a warm fire, drinking a glass of wine and telling stories.CONNECT WITH CHARLOTTEwww.CharlotteRaine.comfacebook.com/ILoveRomanticSuspense twitter.com/crainebooksCRaineBooks@gmail.comSERIES INFORMATIONTitanium Blood#1 Blood Family (currently free)#2 Blood Run#3 Blood Honor (coming soon)A Grace Ellery Series#1 Teacher Beware (currently free)#2 Disturbed MindA Grant & Daniels Series#1 Midnight Sun#2 Devil’s Dawn#3 Blood MoonThe Gun Runner Series#1 Major Threat#2 Trigger Point#3 Safe At LastOther BooksDo You Want To Play

 



  1. Thrill Kill by Ann Savage 

ThrillKillAbout Thrill Kill by Ann Savage:

Dr. Leila Maxwell is a forensic specialist, her expertise is at getting the story behind a murder and she’s recognized as one of the best. But she soon meets her match as a serial killer goes on a rampage in San Francisco as numerous prostitutes are found murdered. Her investigation then takes on a whole new sense of urgency when her troubled younger sister is declared missing.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Ann Savage is a writer in the Oakland Bay Area.

 



  1. Generational Curse by Tracy Reed 

GenerationalCurseAbout Generational Curse by Tracy Reed:

Kyla James is a beautiful, confident woman.  She has two vices, champagne and sex with married men.  Like most of the women in her family, being tied down and answering to a man has never appealed to her.  That is, until her friend Sean Prescott presented her with an intriguing proposal.  They’ve been friends and business colleagues for years, but if she accepts his proposal, they could discover something better than friendship.Is it possible for a celibate Christian man to be involved with a woman who has only been the plaything of married men?  Or will she make him the next notch on her belt?

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
I am a single Christian woman who loves God, Fashion and Cute Guys. Not all women who write Christian fiction will admit to that.  The subjects I write about are considered taboo in Christian fiction. If you want to read about Christians dealing with unrequited love, apprehension to give love another chance, arranged marriages, physical attraction, divorce, annulment, controlling their urges, infidelity, abortion, dating younger men, being a single mother, slipping up and sleeping with your estranged ex, standing up for yourself, being honest about not liking your in-laws, still being attracted to your ex, battling postpartum depression, having challenges in your walk with Christ or if you aren’t too proud to admit you sometimes get angry and yell at God, then you’re in the right place.  The people that read my books have a thing for designer clothes and accessories and aren’t ashamed to admit it. To them a cute Christian guy on their arm is the finish to the perfect outfit.  Sort of like lipstick, you don’t have to have it, but it sure makes you feel prettier when you do.

 



  1. Castles in Scotland – A Travellers’ Guide 

Castles_in_ScotlandAbout Castles in Scotland – A Travellers’ Guide:

Scotland is some country. Beautiful, historic and with a tradition all of its own. A big part of that history and tradition are the many magnificent castles which can be found throughout Scotland attracting visitors from all over the world. No visit is complete unless the traveller sees some of these castles. I am no exception – I love Scotland. So I have put together this book to give you an introduction to twenty of my favourite Scottish castles.

Buy the book, and follow the author on social media:
Learn more about the writer. Visit the Author’s Website.
Buy the Book On Amazon.


Author Bio:
Hello there,

My name is Gary McKraken and I’d like to thank you for checking out my book. I’m interested in all sorts of different things in life.

I’m also a keen writer so thought why not put that skill to good use and write/publish books on what I like, what I’m interested in and what others may find helpful.

Thanks again for stopping by.

Gary.

 



  1. Jack: New Beginning by Olivia Bedford 

JackNewBeginningAbout Jack: New Beginning by Olivia Bedford:

Jack, a single father originally from Australia now works in the US as a mines consultant.
He is searching for his two kids. He lost touch with them many years ago.
Through his search though many obstacles are in his path, one of them he didn’t even see coming!

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
I live in Australia, and love the bush. Most of my stories are from these parts of the world.
Out here, are some beautiful landscapes and some interesting characters who I get my inspiration from.
I have always been a day dreamer, ever since I can remember way back at school, I was always getting in trouble for drifting off. But of course when I day dream now, I put it on paper!

 



  1. Webs: Even clever little spiders can get caught in their own webs… (Lily S: Teenage Detective murder mystery series) by Lily Stuart 

WebsEvencleverlittlespiderscangetcaughtintheirownwebsLilySTeenageDetectivemurdermysteryseriesAbout Webs: Even clever little spiders can get caught in their own webs… (Lily S: Teenage Detective murder mystery series) by Lily Stuart:

Coming of age teen detective suspense thriller with a ton of humour thrown in… Webs is the first book in the bestseller Lily S: Teen Detective series of mysteries and thrillers.Girl sleuth, sixteen-year-old Lily’s policeman Dad is trying to untangle a particularly nasty death and Lily’s intrigued. She’s even more intrigued when she proves to him it’s actually murder. Perhaps she’d make a detective too? If only she could work out what would get Dad to dump awful Ange, grovel, and patch things up with Mum. Irritating isn’t the word!In retaliation, for awful Ange, Lily’s mum resorts to the web for romance; the world-wide-web. Convinced she can get her parents back together, Lily resorts to her own bit of web-weaving to trip up the candidates for replacement daddy. Whilst her school friends are up to their usual tricks; Matt is alternately ignoring and chasing her, Melezz is being the worst best friend, and Jacob is up to no good with his nipple tassel pranks again, Lily abandons the teen girl’s guide to growing up and instead is busy seeking justice – her own kind. The trouble is, whilst Lily thinks she’s playing private investigator and being a clever little spider, weaving clever little traps, one of her prey is smarter still; and deadly. “You have got to read this book. It is awesome!” “I fell in love with Lily, her humor and snarkiness ”” and her bravery.”“Sets the bar high for YA Literature…”“…stands out from all the others….”˃˃˃ Interview with the AuthorQ – So, what makes the Webs special? A – Its completely different. And if you’re a fan of Veronica Mars, Nancy Drew, Janet Evanovich’s books on Stephanie Plum or Meg Cabot’s Size 12 books featuring Heather Wells and want more fly-on-the-wall teenage realism than fictional fantasy, you’ll love it. The characters are based on real life, and as teenagers are the wittiest, craziest people I know; and the most interesting. Who needs fantasy? Laughter mixed with tricky plot twists and a dark, dark mind waiting quietly to catch Lily in his own web…Q – What order should I read the Lily S: Teenage Detective series books in? A – The series runs in a sequence, with the second book due out this year, but the stories are complete in themselves. To get the most out of them, though, I think the best order to read in is: – Webs – Magpies (out Autumn 2015) – Gone (out Summer 2016)Then you’ll get all the gags, including the long-running ones, and all the back stories.Q – So, why should readers give these books a try? A – When I wrote Webs it started out really dark; noir, and I added Lily to create light within the shade. But everyone who read the book before its publication loved Lily so much, in the end she took over, and they loved it even more. But Webs isn’t just the first in another teenage detective series. This is Lily’s life, loves, fixes and dilemmas as well as her private investigation work. Lily is real ”” sharp, witty, cool; and vulnerable. She’s potentially me at sixteen, or you; and the humour will keep you laughing even as you’re desperately flipping the pages to find out what happens next. Q – Can readers collect the whole series in one go? A – Hop over to my author page here at Amazon to find out how to be the first in the know, and a full list of my available titles as I also write psychological thrillers and literary fiction under other pen names. And thanks for reading!

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Lily Stuart is the pen name I use for my YA novels. You can find the real writer behind the name in the biography under the author name D.B. Martin.As well as YA novels, I write adult thriller and literary fiction under the names of D.B. Martin and Debrah Martin. Sign up to my newsletter list here: http://eepurl.com/3-965 and be the first to hear about new releases, special offers and which book is currently available free. You can also find out about all of my books on my website www.debrahmartin.co.uk

 



  1. Magpies: All their deadly little treasures (Lily S: Teenage Detective murder mystery series) by Lily Stuart 

MagpiesAlltheirdeadlylittletreasuresLilySTeenageDetectivemurdermysteryseries1About Magpies: All their deadly little treasures (Lily S: Teenage Detective murder mystery series) by Lily Stuart:

THE teen detective is back, and looking for trouble…or rather trouble’s looking for her. They find each other in the series of little mysteries that start cropping up as soon as Lily’s back at school after her brush with death, and meets the new boy, Si. He’s different, like Lily is now, with her occasional narcolepsy and frequent inclination to be a private investigator about everything – but different never featured in the teen girl’s guide to growing up.And whereas Lily watches and works things out, Si blurts it all out at the wrong time and in the wrong way. He has Tourettes. He also has a way with rhymes; one in particular that increasingly makes sense to Lily as the mysteries mount up, including one which might mean murder. One for sorrow, two for joy, three for -But joy is no longer a girl’s name nor the opposite of sad, and the magpies the rhyme is about are not just black and white birds that like stealing treasure. They’re far more deadly than that. As Lily plays girl sleuth and figures out just what they really are, justice looks like the last thing she can hope for – along with coming of age, if they have anything to do with it… Magpies is the second book in the Lily S: Teenage Detective series of suspense thrillers. Interview with the AuthorQ – So, what makes Magpies special? A – It’s completely different. And if you’re a fan of Veronica Mars, Nancy Drew, Janet Evanovich’s books on Stephanie Plum or Meg Cabot’s Size 12 books featuring Heather Wells and want more fly-on-the-wall teenage realism than fictional fantasy, you’ll love it. The characters are based on real life, and as teenagers are the wittiest, craziest people I know; and the most interesting. Who needs fantasy? But there are real life issues involved too, like love, frenemies, being different and fitting in despite that. It’s a coming of age mix of finding themselves and losing themselves too.Q – What order should I read the Lily S: Teenage Detective series books in? A – The series runs in a sequence, with the second book due out shortly, but the stories are complete in themselves. To get the most out of them, though, I think the best order to read in is: – Webs – Magpies – Gone (out Summer 2016)Then you’ll get all the gags, including the long-running ones, and all the back stories.Q – So, why should readers give these books a try? A – When I wrote Webs it started out really dark; noir, and I added Lily to create light within the shade. But everyone who read the book before its publication loved Lily so much, in the end she took over, and they loved it even more. Magpies is less dark, but equally tricky. Even though a teenage detective may be smarter than the average nerd, it doesn’t mean she ”” or her friends ”” can work it all out right first time round. And being a teenage detective definitely makes you NOT one of the crowd; different. That’s a difficult concept for anyone to come to terms with, let alone someone also dealing with emotions, sex, standing by your principles, working out who you can rely on and who you can’t ”” and growing up. Appearances are still deceptive, even when you think there’s nothing else they can hide. This isn’t just a teenage detective series. This is Lily’s life, loves, fixes and dilemmas as well as her private investigation work. Lily is real; sharp, witty, cool, and vulnerable. She’s potentially me at sixteen, or you; and the humour will keep you laughing even as you’re desperately flipping the pages to find out what happens next. Q – Can readers collect the whole series in one go? A – Hop over to my author page here at Amazon to find out how to be the first in the know, and see a full list of my available titles under other pen names. And thanks for reading!

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Lily Stuart is the pen name I use for my YA novels. You can find the real writer behind the name in the biography under the author name D.B. Martin.As well as YA novels, I write adult thriller and literary fiction under the names of D.B. Martin and Debrah Martin. Sign up to my newsletter list here: http://eepurl.com/3-965 and be the first to hear about new releases, special offers and which book is currently available free. You can also find out about all of my books on my website www.debrahmartin.co.uk

 



  1. Falling Awake: The impossible is just a breath away by Debrah Martin 

FallingAwakeTheimpossibleisjustabreathaway1About Falling Awake: The impossible is just a breath away by Debrah Martin:

Are dreams mere fantasy, or are they real?When Mary Parker finds a magic book everything in her life changes. As she reads, she dreams, and the woman sunk in depression after her mother’s death is transformed to a vibrant beauty. She gives the book and the phenomenon a name, ‘falling awake’. The book seems to twist others to act out of character too. Joe’s usually dour father turns visionary and gambles with the factory where Mary works, and Joe, the metaphysical daydreamer, engages in a secret sexual eternal triangle to keep the dull routine of the accounts department at bay. The dominant partner in the triangle is Clem; dark and dangerous. Extricating himself from Clem, Joe meets Mary. They fall in love and their marriage is arranged in haste when Mary falls pregnant, but this is no happy ever after tale. Their joy turns to grief when Mary miscarries and she turns inward to her darkening ‘falling awake’ world – now more psychic than real. Then Joe’s father dies, and he has to fight for control of the factory. He falls into Clem’s clutches again, and to make things worse, he believes Mary is going mad, and the people and places she remembers all just dreams dreamt inside her insanity. But then how can Joe remember them too? Magic or madness? Karma or crazy? For Mary and Joe, the impossible – and the deadly ghosts of their dreams – are only a breath away. Falling Awake is a dark paranormal romance thriller about a girl, a book, love and loss, mental illness, mystery and magic.“In the best traditions of Audrey Niffenegger and Carlos Ruiz Zafón.”“Mind-blowing, real, or unreal? Possible or incredible? Simply brilliant!”“A superb piece of literary fiction.”Scroll up and grab a copy today.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Debrah Martin is a British author, writing psychological thrillers as D.B. Martin and literary fiction as Debrah Martin. She also writes a YA teen detective series under the pen name Lily Stuart; irreverent, blunt, funny and vulnerable. She lives near Oxford in the UK with her daughters, and teaches creative writing and publishing when she’s not planning another mind-twisting plot. If you would like to read one of her books free of charge, sign up to her newsletter list here: http://eepurl.com/3-965 and be surprised!You can also find out about all of her books on her website www.debrahmartin.co.uk “Books are a chance to visit a world that you wouldn’t otherwise experience. As long as someone enjoys slipping into the other worlds that I write about, I’ll keep opening the doors for them. Dance in the rain, live in the sunlight, explore in your imagination…”

 



  1. Chained Melodies: Courage isn’t about facing death, it’s about facing life – and life isn’t always conventional: a contemporary adult romance novel by Debrah Martin 

ChainedMelodiesCourageisntaboutfacingdeathitsaboutfacinglifeandlifeisntalwaysconventionalacontemporaryadultromancenovel1About Chained Melodies: Courage isn’t about facing death, it’s about facing life – and life isn’t always conventional: a contemporary adult romance novel by Debrah Martin:

An extraordinary transgender love story about transition, revelation, self-belief and the true nature of courage.If chaos theory applied to anyone, it’s Will and Tom. Best friends since childhood, life takes very different courses for them until they’re thrown back together in the middle of their own individual chaos. Surviving the terrors of war in Northern Ireland and the heartbreak of childlessness and a broken marriage, Tom learns that courage isn’t about daring death, it’s about facing life, and he’s never been good at that. For Will, it’s about being yourself – in his case, a very different kind of self; a woman called Billie. As Will transitions from male to female, so the once-close friendship between Tom and Will changes too – from surprise to grudging respect, to admiration and eventually to love. But it takes more than love to face a world of prejudice and a life-time of stereotyping – it takes courage, and Tom has always had a problem with that, despite being the archetypal alpha male. And when an unexpected tragedy throws both Tom and Billie into the public eye, courage becomes more than an issue, it becomes the difference between life and death. >“…it’s not a transsexual love story, it’s a love story that happens to feature transsexuals. The author did an amazing job making the characters three-dimensional and their self-discovery journey is transforming not just for them, but the reader too.””Touching and almost heart-breaking, this is a novel to tickle your heart strings.”“…breath-taking and intriguing…”“…a “must read” novel.’””…quite beautiful, with a certain poetry in the tone.” Scroll up and grab a copy today.

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Debrah Martin is a British author, writing psychological thrillers as D.B. Martin and literary fiction as Debrah Martin. She also writes a YA teen detective series under the pen name Lily Stuart; irreverent, blunt, funny and vulnerable. She lives near Oxford in the UK with her daughters, and teaches creative writing and publishing when she’s not planning another mind-twisting plot. If you would like to read one of her books free of charge, sign up to her newsletter list here: http://eepurl.com/3-965 and be surprised!You can also find out about all of her books on her website www.debrahmartin.co.uk “Books are a chance to visit a world that you wouldn’t otherwise experience. As long as someone enjoys slipping into the other worlds that I write about, I’ll keep opening the doors for them. Dance in the rain, live in the sunlight, explore in your imagination…”

 



  1. Moon (Gemini Series Book 1) by Don McAuley 

MoonGeminiSeriesBook1About Moon (Gemini Series Book 1) by Don McAuley:

A systems failure on an Apollo Lunar Module turns from bad to worse in an instant.

Astronauts John Campbell and Bill Goodwin face a problem so unexpected, it’s never been faced before. Their experience turns their belief systems upset down. The way they look at the sky. The way they believe what they’re told. Everything changed forever.

Not that it will matter much. Not from their lonely spot thousands of miles away. They have only hours to find a solution. If they don’t, the moon will become their final resting place, taking their secret with it.

Welcome to Moon, the first short story of the Gemini series. This tense, action-packed thriller reveals the race to survive against dwindling life support in a hostile world. If you love sci-fi with mystery and suspense, ‘Moon’ is one-click away.

To fully enjoy the Gemini series, they should be read in the following order:

Moon
Storms
Ancient

Buy the book, and follow the author on social media:
Buy the Book On Amazon.


Author Bio:
Don McAuley writes action-adventure stories with a healthy sprinkling of sci-fi and mystery.

He lives on a remote hill farm and when he’s not at his writing desk he’s probably banging in some fence posts to repair the miles of fencing.

He loves unexplained mysteries, ancient sites and poking behind the news to see if there’s a story idea he can work on.

The Gemini Series provides great entertainment with a page-turning plot whilst leaving the reader with a few intriguing questions at the end. Why? Because that’s the sort of books he like to read and hopes you will too.

Sign up for latest news at:donmcauley.com/signup

 



 

Thanks for being awesome and supporting the authors.